PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pta005603
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pinus; Pinus
Family HB-other
Protein Properties Length: 171aa    MW: 19606.1 Da    PI: 9.1921
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Pinus_taeda-47892PU_refplantGDBView CDS
gnl|UG|Pta#S26636129PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox711.4e-221873156
               TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
               r++ +++t++q++eLe+lF+k+++p++++r +L++ lgL+ rqVk+WFqNrR+++k
  Pta005603 18 RKRYHRHTAHQIQELEALFKKHPHPDEKQRLQLSRDLGLEPRQVKFWFQNRRTQMK 73
               789999***********************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.4E-23469IPR009057Homeodomain-like
SuperFamilySSF466891.34E-21875IPR009057Homeodomain-like
PROSITE profilePS5007117.9611575IPR001356Homeobox domain
SMARTSM003891.3E-191679IPR001356Homeobox domain
CDDcd000862.48E-171875No hitNo description
PfamPF000463.8E-201873IPR001356Homeobox domain
PRINTSPR000318.4E-54655IPR000047Helix-turn-helix motif
PROSITE patternPS0002705073IPR017970Homeobox, conserved site
PRINTSPR000318.4E-55571IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 171 aa     Download sequence    Send to blast
MEGSGSDQDA ADQQNPARKR YHRHTAHQIQ ELEALFKKHP HPDEKQRLQL SRDLGLEPRQ  60
VKFWFQNRRT QMKAQGERAD NNTLRAENER IRGENLAIRE ALKYVLCSNC GGPPAGETSF  120
EEQHRLRLEN ARLKEELDRL SGIAAKYIGR PIQTTASLHP ISMPSLDMGM V
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011625254.12e-78PREDICTED: homeobox-leucine zipper protein ROC8 isoform X2
RefseqXP_011625255.11e-78PREDICTED: homeobox-leucine zipper protein ROC8 isoform X3
SwissprotQ69T588e-69ROC8_ORYSJ; Homeobox-leucine zipper protein ROC8
TrEMBLA0A0C9QWV42e-83A0A0C9QWV4_9SPER; TSA: Wollemia nobilis Ref_Wollemi_Transcript_2540_2939 transcribed RNA sequence
STRINGGLYMA05G33520.13e-72(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73360.17e-70homeodomain GLABROUS 11